Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM3 Peptide - middle region

MCM3 Peptide - middle region

Product Specifications

Product Name Alternative

HCC5, P1.h, RLFB, P1-MCM3

UniProt

P25205

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257401.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GNB2 Monoclonal Antibody
E-AB-81563-01 50 µL

Recombinant GNB2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant GNB2 Monoclonal Antibody
E-AB-81563-02 100 µL

Recombinant GNB2 Monoclonal Antibody

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2441), CF594 conjugate, 0.1mg/mL
BNC942441-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2441), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Normal Colon Fibroblasts
C05DON 1000000 Cells

Normal Colon Fibroblasts

Sign In for Pricing
View Details
(2Beta,3Alpha,5Alpha,16Beta,17Beta)-2,16-di-1-Pyrrolidinylandrostane-3,17-diol
TRC-P998580-1MG 1 mg

(2Beta,3Alpha,5Alpha,16Beta,17Beta)-2,16-di-1-Pyrrolidinylandrostane-3,17-diol

Sign In for Pricing
View Details
2,4-Xylenesulfonic Acid
TRC-X749510-1G 1 g

2,4-Xylenesulfonic Acid

Sign In for Pricing
View Details