UVRAG Peptide - middle region
UVRAG Peptide - middle region
Product Specifications
Product Name Alternative
P63, DHTX, VPS38
UniProt
Q9P2Y5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003360.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGETERK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
244614-APC 100 µL
CER1 (cerberus 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), DAND4, MGC119894, MGC119895, MGC96951) (APC)
Sign In for Pricing
View Details 
14932151 3x 1.0 µg DNA
CALM1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details