Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UVRAG Peptide - middle region

UVRAG Peptide - middle region

Product Specifications

Product Name Alternative

P63, DHTX, VPS38

UniProt

Q9P2Y5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003360.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGETERK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal MHC Class II Antibody (ER-TR2)
NB100-64959-0.025mg 0.025 mg

Rat Monoclonal MHC Class II Antibody (ER-TR2)

Sign In for Pricing
View Details
CLCN3 Protein Vector (Human) (pPM-C-His)
PV069748 500 ng

CLCN3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-HMGB1 Antibody, Rabbit Polyclonal
MBS8124620-01 0.1 mL

Anti-HMGB1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-HMGB1 Antibody, Rabbit Polyclonal
MBS8124620-02 5x 0.1 mL

Anti-HMGB1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Endoglin Human Recombinant, Sf9
rAP-0410 1 Each

Endoglin Human Recombinant, Sf9

Sign In for Pricing
View Details
IL-8RB Double Nickase Plasmid (m2)
sc-419698-NIC-2 20 µg

IL-8RB Double Nickase Plasmid (m2)

Sign In for Pricing
View Details