Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S1PR2 Peptide - middle region

S1PR2 Peptide - middle region

Product Specifications

Product Name Alternative

EDG5, H218, LPB2, S1P2, AGR16, EDG-5, Gpcr13

UniProt

O95136

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004221.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLQCWRPGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGA2, CT (High Mobility Group AT-hook Protein 2, BABL, High Mobility Group Protein HMGI-C, HMGIC, LIPO, STQTL9) (MaxLight 405) discontinued
036635-ML405 100 µL

HMGA2, CT (High Mobility Group AT-hook Protein 2, BABL, High Mobility Group Protein HMGI-C, HMGIC, LIPO, STQTL9) (MaxLight 405) discontinued

Sign In for Pricing
View Details
1,4-Dihydroxynaphthalene
411334-01 1 g

1,4-Dihydroxynaphthalene

Sign In for Pricing
View Details
1,4-Dihydroxynaphthalene
411334-02 5 g

1,4-Dihydroxynaphthalene

Sign In for Pricing
View Details
1- (3-Methyl-1-phenyl-5-pyrazolyl) Piperazine
HY-I0140-01 500 mg

1- (3-Methyl-1-phenyl-5-pyrazolyl) Piperazine

Sign In for Pricing
View Details
1- (3-Methyl-1-phenyl-5-pyrazolyl) Piperazine
HY-I0140-02 1 g

1- (3-Methyl-1-phenyl-5-pyrazolyl) Piperazine

Sign In for Pricing
View Details
1- (3-Methyl-1-phenyl-5-pyrazolyl) Piperazine
HY-I0140-03 5 g

1- (3-Methyl-1-phenyl-5-pyrazolyl) Piperazine

Sign In for Pricing
View Details