Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S1PR2 Peptide - middle region

S1PR2 Peptide - middle region

Product Specifications

Product Name Alternative

EDG5, H218, LPB2, S1P2, AGR16, EDG-5, Gpcr13

UniProt

O95136

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004221.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLQCWRPGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM40 Protein Vector (Mouse) (pPM-C-HA)
PV241552 500 ng

TRIM40 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CDIPT (NM_006319) Human Over-expression Lysate
LS010423-100ug 100 µg

CDIPT (NM_006319) Human Over-expression Lysate

Sign In for Pricing
View Details
Methyl 4-azaspiro[2.5]octane-7-carboxylate hydrochloride
DQD63026-01 100 mg

Methyl 4-azaspiro[2.5]octane-7-carboxylate hydrochloride

Sign In for Pricing
View Details
Methyl 4-azaspiro[2.5]octane-7-carboxylate hydrochloride
DQD63026-02 250 mg

Methyl 4-azaspiro[2.5]octane-7-carboxylate hydrochloride

Sign In for Pricing
View Details
Polyclonal Antibody to Solute Carrier Family 27 Member 5 (SLC27A5)
TRV-0046490-01 20 µL

Polyclonal Antibody to Solute Carrier Family 27 Member 5 (SLC27A5)

Sign In for Pricing
View Details
Polyclonal Antibody to Solute Carrier Family 27 Member 5 (SLC27A5)
TRV-0046490-02 100 µL

Polyclonal Antibody to Solute Carrier Family 27 Member 5 (SLC27A5)

Sign In for Pricing
View Details