Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDGF Peptide - middle region

HDGF Peptide - middle region

Product Specifications

Product Name Alternative

HMG1L2

UniProt

P51858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119522.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-(+)-Raffinose Pentahydrate
TRC-R073000-50G 50 g

D-(+)-Raffinose Pentahydrate

Sign In for Pricing
View Details
Floor Standing Shaking Incubator BSFT-2001
BSFT-2001 1 Unit

Floor Standing Shaking Incubator BSFT-2001

Sign In for Pricing
View Details
VPAC2 (VIPR2) Rabbit Polyclonal Antibody
AP01437PU-N 100 µg

VPAC2 (VIPR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Integrin alpha 3 (ITGA3) Rabbit Polyclonal Antibody
AP20567PU-N 100 µg

Integrin alpha 3 (ITGA3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Des-(Cyclohexa-2,5-dien-1-one) Androsta-(E)-3-oxobut-1-en-1-yl-2,3,4-13C3)
TRC-D695434-1MG 1 mg

Des-(Cyclohexa-2,5-dien-1-one) Androsta-(E)-3-oxobut-1-en-1-yl-2,3,4-13C3)

Sign In for Pricing
View Details
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF488A conjugate, 0.1mg/mL
BNC882041-100 1x 100 µL

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details