Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDGF Peptide - middle region

HDGF Peptide - middle region

Product Specifications

Product Name Alternative

HMG1L2

UniProt

P51858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119522.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,5-Dihydroxybenzoic Acid Butylamine Salt [Matrix for MALDI-TOF/MS]
TRC-D679195-10MG 10 mg

2,5-Dihydroxybenzoic Acid Butylamine Salt [Matrix for MALDI-TOF/MS]

Sign In for Pricing
View Details
KEL (NM_000420) Human Over-expression Lysate
LY400148 100 µg

KEL (NM_000420) Human Over-expression Lysate

Sign In for Pricing
View Details
PFDN1 (NM_002622) Human Over-expression Lysate
LC419197 20 µg

PFDN1 (NM_002622) Human Over-expression Lysate

Sign In for Pricing
View Details
OIF (OGN) (NM_033014) Human Over-expression Lysate
LY403216 100 µg

OIF (OGN) (NM_033014) Human Over-expression Lysate

Sign In for Pricing
View Details
URG4 (URGCP) (NM_001077663) Human Over-expression Lysate
LY421472 100 µg

URG4 (URGCP) (NM_001077663) Human Over-expression Lysate

Sign In for Pricing
View Details
CD61 (ITGB3) Rabbit Polyclonal Antibody
AP08064PU-N 100 µL

CD61 (ITGB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details