Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDGF Peptide - middle region

HDGF Peptide - middle region

Product Specifications

Product Name Alternative

HMG1L2

UniProt

P51858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119522.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

First Strand cDNA Human Placenta
CH1014 30 Reactions

First Strand cDNA Human Placenta

Sign In for Pricing
View Details
Hsp22 (HSPB8) Human Gene Knockout Kit (CRISPR)
KN401040 1 Kit

Hsp22 (HSPB8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PMP22 Recombinant Rabbit monoclonal Antibody [JM52-30]
ET1705-15-50UL 50 µL

PMP22 Recombinant Rabbit monoclonal Antibody [JM52-30]

Sign In for Pricing
View Details
Human ZNF154 activation kit by CRISPRa
GA105268 1 Kit

Human ZNF154 activation kit by CRISPRa

Sign In for Pricing
View Details
Nat8f5 Mouse Gene Knockout Kit (CRISPR)
KN503518 1 Kit

Nat8f5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tmed1 Mouse Gene Knockout Kit (CRISPR)
KN517676 1 Kit

Tmed1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details