Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDGF Peptide - middle region

HDGF Peptide - middle region

Product Specifications

Product Name Alternative

HMG1L2

UniProt

P51858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119522.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (GYPA/280), CF568 conjugate, 0.1mg/mL
BNC680280-500 1x 500 µL

Glycophorin A / CD235a (GYPA/280), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG,  40nm
GAF-012-40 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, 40nm

Sign In for Pricing
View Details
IL1 beta (IL1B) Rabbit Monoclonal Antibody
TA422836 100 µL

IL1 beta (IL1B) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NAPSIN A (NAPSA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G9]
TA807838AM 100 µL

NAPSIN A (NAPSA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G9]

Sign In for Pricing
View Details
CYB5R3 Rabbit Polyclonal Antibody
TA375260 100 µL

CYB5R3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Elavl3 / Elavl4 Antibody
RC-5191-01 50 μL

Recombinant Elavl3 / Elavl4 Antibody

Sign In for Pricing
View Details