Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF5 Peptide - N-terminal region

FGF5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HBGF-5, TCMGLY, Smag-82

UniProt

P12034

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004455.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS12 (NM_001142538) Human Over-expression Lysate
LY428159 100 µg

LGALS12 (NM_001142538) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC31A1 Human Gene Knockout Kit (CRISPR)
KN401980 1 Kit

SLC31A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Neuropeptide S (NPS) ELISA Kit
RDR-NPS-Hu-01 96 Tests

Human Neuropeptide S (NPS) ELISA Kit

Sign In for Pricing
View Details
Human Neuropeptide S (NPS) ELISA Kit
RDR-NPS-Hu-02 48 Tests

Human Neuropeptide S (NPS) ELISA Kit

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), CF640R conjugate, 0.1mg/mL
BNC400010-100 1x 100 µL

MART-1 / Melan-A (M2-9E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WSB2 (C-term) Rabbit Polyclonal Antibody
AP17836PU-N 400 µL

WSB2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details