Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF5 Peptide - N-terminal region

FGF5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HBGF-5, TCMGLY, Smag-82

UniProt

P12034

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004455.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL5A (NM_012097) Human Recombinant Protein
TP315504M 100 µg

ARL5A (NM_012097) Human Recombinant Protein

Sign In for Pricing
View Details
FAM189A1 (NM_015307) Human Over-expression Lysate
LY429457 100 µg

FAM189A1 (NM_015307) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS711722 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details
Human ACOT1 activation kit by CRISPRa
GA118652 1 Kit

Human ACOT1 activation kit by CRISPRa

Sign In for Pricing
View Details
GATA3 Rabbit Polyclonal Antibody
ER1901-20 100 µL

GATA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PHACTR1 activation kit by CRISPRa
GA116634 1 Kit

Human PHACTR1 activation kit by CRISPRa

Sign In for Pricing
View Details