Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NASP Peptide - middle region

NASP Peptide - middle region

Product Specifications

Product Name Alternative

HMDRA1, FLB7527, PRO1999

UniProt

P49321

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001182122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETEGSEEDDKENDKTEEMPNDSVLENKSLQENEEEEIGNLELAWDMLDLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp423 Mouse Gene Knockout Kit (CRISPR)
KN519832 1 Kit

Zfp423 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sh2d1a Mouse Gene Knockout Kit (CRISPR)
KN515699 1 Kit

Sh2d1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TDRKH (NM_001083964) Human Over-expression Lysate
LY421263 100 µg

TDRKH (NM_001083964) Human Over-expression Lysate

Sign In for Pricing
View Details
HOXD9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H10]
TA809664BM 100 µL

HOXD9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H10]

Sign In for Pricing
View Details
CD200 (NM_005944) Human Over-expression Lysate
LY401799 100 µg

CD200 (NM_005944) Human Over-expression Lysate

Sign In for Pricing
View Details
BrdU Recombinant Mouse monoclonal Antibody
HA610183 100 µg

BrdU Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details