Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NASP Peptide - middle region

NASP Peptide - middle region

Product Specifications

Product Name Alternative

HMDRA1, FLB7527, PRO1999

UniProt

P49321

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001182122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETEGSEEDDKENDKTEEMPNDSVLENKSLQENEEEEIGNLELAWDMLDLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS620281 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Human TMEFF1 activation kit by CRISPRa
GA105687 1 Kit

Human TMEFF1 activation kit by CRISPRa

Sign In for Pricing
View Details
Lime1 (86-202) Mouse Monoclonal Antibody [Clone ID: mLIME-05]
AM12130PU-N 100 µg

Lime1 (86-202) Mouse Monoclonal Antibody [Clone ID: mLIME-05]

Sign In for Pricing
View Details
ZC3HC1 Antibody
KC-3605-01 50 μL

ZC3HC1 Antibody

Sign In for Pricing
View Details
ZC3HC1 Antibody
KC-3605-02 100 µL

ZC3HC1 Antibody

Sign In for Pricing
View Details
ZC3HC1 Antibody
KC-3605-03 1 mL

ZC3HC1 Antibody

Sign In for Pricing
View Details