Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBB Peptide - C-terminal region

UBB Peptide - C-terminal region

Product Specifications

Product Name Alternative

HEL-S-50

UniProt

P0CG47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001268645.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ncapd2 shRNA (UAS) - Lentiviral mouse Ncapd2 shRNA (UAS, iRFP) plasmid
GTR15212020 1 Vial

Lentiviral mouse Ncapd2 shRNA (UAS) - Lentiviral mouse Ncapd2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Human TERF1 Protein, N-GST
HX209012-01 50 µg

Recombinant Human TERF1 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human TERF1 Protein, N-GST
HX209012-02 100 µg

Recombinant Human TERF1 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human TERF1 Protein, N-GST
HX209012-03 1 mg

Recombinant Human TERF1 Protein, N-GST

Sign In for Pricing
View Details
Human mannan binding lectin associated serine protease (MASP) ELISA Kit
GA-E0739HM-01 48 Tests

Human mannan binding lectin associated serine protease (MASP) ELISA Kit

Sign In for Pricing
View Details
Human mannan binding lectin associated serine protease (MASP) ELISA Kit
GA-E0739HM-02 96 Tests

Human mannan binding lectin associated serine protease (MASP) ELISA Kit

Sign In for Pricing
View Details