Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBB Peptide - C-terminal region

UBB Peptide - C-terminal region

Product Specifications

Product Name Alternative

HEL-S-50

UniProt

P0CG47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001268645.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFP/eGFP-Tag (AB1999) Rabbit mAb
M3329-01 20 µL

GFP/eGFP-Tag (AB1999) Rabbit mAb

Sign In for Pricing
View Details
GFP/eGFP-Tag (AB1999) Rabbit mAb
M3329-02 50 μL

GFP/eGFP-Tag (AB1999) Rabbit mAb

Sign In for Pricing
View Details
GFP/eGFP-Tag (AB1999) Rabbit mAb
M3329-03 100 µL

GFP/eGFP-Tag (AB1999) Rabbit mAb

Sign In for Pricing
View Details
GFP/eGFP-Tag (AB1999) Rabbit mAb
M3329-04 200 µL

GFP/eGFP-Tag (AB1999) Rabbit mAb

Sign In for Pricing
View Details
NOTCH4 Rabbit Polyclonal Antibody (Fluoro550)
orb3081598 100 µg

NOTCH4 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
DL-Glutamic acid
HY-W041895-01 500 mg

DL-Glutamic acid

Sign In for Pricing
View Details