Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA5 Peptide - middle region

KCNA5 Peptide - middle region

Product Specifications

Product Name Alternative

HK2, HCK1, PCN1, ATFB7, HPCN1, KV1.5

UniProt

Q16322

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002225.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSKH2 Antibody
OAGA02629-100UL 100 µL

PSKH2 Antibody

Sign In for Pricing
View Details
ST2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
45626151 3x 1.0 µg DNA

ST2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
TRIM54 (FITC)
580042-01 50 µg

TRIM54 (FITC)

Sign In for Pricing
View Details
TRIM54 (FITC)
580042-02 100 µg

TRIM54 (FITC)

Sign In for Pricing
View Details
Mouse SR-AI/MSR1 Affinity Purified Polyclonal Ab
AF1797-SP 25 µg

Mouse SR-AI/MSR1 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
USP22 Rabbit mAb
A9261-01 20 µL

USP22 Rabbit mAb

Sign In for Pricing
View Details