What is the catalog number for KCNA5 Peptide - middle region?

The catalog number for KCNA5 Peptide - middle region is orb1999214.

What sizes are available for KCNA5 Peptide - middle region?

KCNA5 Peptide - middle region is available in the following size(s): 100 µg.

Is KCNA5 Peptide - middle region in stock?

KCNA5 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

KCNA5 Peptide - middle region

Product Specifications

Product Name Alternative

HK2, HCK1, PCN1, ATFB7, HPCN1, KV1.5

UniProt

Q16322

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002225.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVFADEIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-430904-NIC-2 20 µg

SLD5 Double Nickase Plasmid (m2)

Sign In for Pricing

View Details

E2411 96 Tests

Immunoglobulin superfamily member 21 (IGSF21) Mouse ELISA Kit

Sign In for Pricing

View Details

25801106 1 µg

KLHL36 AAV Vector (Rat) (CMV)

Sign In for Pricing

View Details

12974031 100 µg

BACH1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing

View Details

bs-3333R-Cy7 100 µL

Phospho-PKC alpha (Thr638) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing

View Details

MBS2523584-01 0.02 mL

BRINP1 Polyclonal Antibody

Sign In for Pricing

View Details