Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNE2 Peptide - N-terminal region

CCNE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CYCE2

UniProt

O96020

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_477097.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2-((1R,4R)-4-((tert-Butoxycarbonyl)amino)cyclohexyl)acetate
TRC-E662855-500MG 500 mg

Ethyl 2-((1R,4R)-4-((tert-Butoxycarbonyl)amino)cyclohexyl)acetate

Sign In for Pricing
View Details
TGIF (TGIF1) (NM_173211) Human Over-expression Lysate
LY430398 100 µg

TGIF (TGIF1) (NM_173211) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MITD1 activation kit by CRISPRa
GA115085 1 Kit

Human MITD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Vimentin (VM452), CF740 conjugate, 0.1mg/mL
BNC740452-100 1x 100 µL

Vimentin (VM452), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLBD2 (NM_001159727) Human Over-expression Lysate
LC431479 20 µg

PLBD2 (NM_001159727) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS503882 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details