Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD23B Peptide - middle region

RAD23B Peptide - middle region

Product Specifications

Product Name Alternative

P58, HR23B, HHR23B

UniProt

P54727

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001231653.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRP1 Human
32-6504-2 2 µg

NRP1 Human

Sign In for Pricing
View Details
CALB1 (calbindin 1, 28kD, CALB) (FITC)
MBS6178770-01 0.1 mL

CALB1 (calbindin 1, 28kD, CALB) (FITC)

Sign In for Pricing
View Details
CALB1 (calbindin 1, 28kD, CALB) (FITC)
MBS6178770-02 5x 0.1 mL

CALB1 (calbindin 1, 28kD, CALB) (FITC)

Sign In for Pricing
View Details
Ezrin/Radixin Rabbit Polyclonal Antibody
orb526534-01 50 μL

Ezrin/Radixin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ezrin/Radixin Rabbit Polyclonal Antibody
orb526534-02 100 µL

Ezrin/Radixin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ezrin/Radixin Rabbit Polyclonal Antibody
orb526534-03 200 µL

Ezrin/Radixin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details