Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD23B Peptide - middle region

RAD23B Peptide - middle region

Product Specifications

Product Name Alternative

P58, HR23B, HHR23B

UniProt

P54727

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001231653.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXYD4 Human Gene Knockout Kit (CRISPR)
KN408892 1 Kit

FXYD4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM108A10P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV725080 1.0 µg DNA

FAM108A10P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Enokizumab
E40YR1241 1 mg

Enokizumab

Sign In for Pricing
View Details
Bile SaL Reagent Solution
41400500 500 mL

Bile SaL Reagent Solution

Sign In for Pricing
View Details
Mouse IL36A/IL-1F6 Polyclonal Antibody
E55A04003 100 µg

Mouse IL36A/IL-1F6 Polyclonal Antibody

Sign In for Pricing
View Details
Histidyl-tRNA Synthetase (HARS) AssayLite™ Antibody (RPE Conjugate)
30049-05151 5x 30 µg

Histidyl-tRNA Synthetase (HARS) AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details