POLB Peptide - middle region
POLB Peptide - middle region
Product Specifications
UniProt
P06746
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002681.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSE
More Discoveries
Explore Other Products
Browse additional items from our catalog
CABT-ZB147 1 mg
Human Anti-Human TK1 monoclonal antibody, Clone B22
Sign In for Pricing
View Details 12-8263-1 1 mg
Anti-SARS-CoV-1, Spike RBD (Clone COV1-90) -Purified No Carrier Protein
Sign In for Pricing
View Details QP11784-HIS-100ug 100ug
Recombinant Human En Protein, His, E.coli-100ug
Sign In for Pricing
View Details