POLB Peptide - middle region
POLB Peptide - middle region
Product Specifications
UniProt
P06746
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002681.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ABC-X0938 1 Vial
Xpress™ Human ECI1 Over-expressing Stable Cell Line
Sign In for Pricing
View Details GTR15221933 1 Vial
Lentiviral mouse Zpbp2 shRNA (UAS) - Lentiviral mouse Zpbp2 shRNA (UAS) (25)
Sign In for Pricing
View Details MBS6488534-01 0.2 mL
MOSC2, CT (MOSC Domain-containing Protein 2 Mitochondrial, FLJ20605, RP11-270A6.1) (APC)
Sign In for Pricing
View Details MBS6488534-02 5x 0.2 mL
MOSC2, CT (MOSC Domain-containing Protein 2 Mitochondrial, FLJ20605, RP11-270A6.1) (APC)
Sign In for Pricing
View Details 