Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADSL Peptide - middle region

ADSL Peptide - middle region

Product Specifications

Product Name Alternative

ASL, AMPS, ASASE

UniProt

P30566

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000017.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FFAR1 shRNA (UAS) - Lentiviral human FFAR1 shRNA (UAS, iRFP) plasmid
GTR15106996 1 Vial

Lentiviral human FFAR1 shRNA (UAS) - Lentiviral human FFAR1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Canine Htra3 ELISA Kit
ECH0019 96 Tests

Canine Htra3 ELISA Kit

Sign In for Pricing
View Details
Rat SET domain-containing protein 5 (SETD5) ELISA Kit
MBS2604915-01 48 Well

Rat SET domain-containing protein 5 (SETD5) ELISA Kit

Sign In for Pricing
View Details
Rat SET domain-containing protein 5 (SETD5) ELISA Kit
MBS2604915-02 96 Well

Rat SET domain-containing protein 5 (SETD5) ELISA Kit

Sign In for Pricing
View Details
Rat SET domain-containing protein 5 (SETD5) ELISA Kit
MBS2604915-03 5x 96 Well

Rat SET domain-containing protein 5 (SETD5) ELISA Kit

Sign In for Pricing
View Details
Rat SET domain-containing protein 5 (SETD5) ELISA Kit
MBS2604915-04 10x 96 Well

Rat SET domain-containing protein 5 (SETD5) ELISA Kit

Sign In for Pricing
View Details