Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADSL Peptide - middle region

ADSL Peptide - middle region

Product Specifications

Product Name Alternative

ASL, AMPS, ASASE

UniProt

P30566

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000017.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAG Antibody (HRP)
orb1671392-01 0.02 mg

GAG Antibody (HRP)

Sign In for Pricing
View Details
GAG Antibody (HRP)
orb1671392-02 0.1 mg

GAG Antibody (HRP)

Sign In for Pricing
View Details
Anti-SORBS1 Picoband® Antibody-iFluor647 Conjugate
A04426-3-iFluor647 100 µg

Anti-SORBS1 Picoband® Antibody-iFluor647 Conjugate

Sign In for Pricing
View Details
BC018761 Recombinant Protein (Human)
RP002773 100 µg

BC018761 Recombinant Protein (Human)

Sign In for Pricing
View Details
Dopamine D5 receptor Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1603462 100 µL

Dopamine D5 receptor Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Goat Polyclonal SCAP2 Antibody
NB110-40659 0.1 mg

Goat Polyclonal SCAP2 Antibody

Sign In for Pricing
View Details