Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLCG1 Peptide - N-terminal region

PLCG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PLC1, NCKAP3, PLC-II, PLC148, PLCgamma1

UniProt

P19174

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002651.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS809204 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
UFM1 Antibody (Biotin)
KB-11549-01 50 μL

UFM1 Antibody (Biotin)

Sign In for Pricing
View Details
UFM1 Antibody (Biotin)
KB-11549-02 100 µL

UFM1 Antibody (Biotin)

Sign In for Pricing
View Details
UFM1 Antibody (Biotin)
KB-11549-03 1 mL

UFM1 Antibody (Biotin)

Sign In for Pricing
View Details
Dinoseb
TRC-D480490-50MG 50 mg

Dinoseb

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS627032 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details