Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLCG1 Peptide - N-terminal region

PLCG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PLC1, NCKAP3, PLC-II, PLC148, PLCgamma1

UniProt

P19174

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002651.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin A (CSTA/2882), CF568 conjugate, 0.1mg/mL
BNC682882-500 1x 500 µL

Cystatin A (CSTA/2882), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pentabromobenzyl Acrylate
TRC-P227120-500MG 500 mg

Pentabromobenzyl Acrylate

Sign In for Pricing
View Details
SYT8 (Center) Rabbit Polyclonal Antibody
AP54128PU-N 400 µL

SYT8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAD18 Rabbit Monoclonal Antibody
TA422637 100 µL

RAD18 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Alpha-Casein (90-96) Trifluoroacetate Salt
TRC-A279400-2.5MG 2.5 mg

Alpha-Casein (90-96) Trifluoroacetate Salt

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS628775 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details