Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGEF2 Peptide - C-terminal region

ARHGEF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GEF, P40, GEFH1, LFP40, GEF-H1

UniProt

Q92974

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001155855.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metamizol Sodium Monohydrate
TRC-M244740-500MG 500 mg

Metamizol Sodium Monohydrate

Sign In for Pricing
View Details
FTS (AKTIP) (NM_001012398) Human Over-expression Lysate
LC422846 20 µg

FTS (AKTIP) (NM_001012398) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluoro 2-Deoxy-2-fluoro-3,4,6-tri-O-acetyl-D-mannopyranoside
TRC-F590300-10MG 10 mg

Fluoro 2-Deoxy-2-fluoro-3,4,6-tri-O-acetyl-D-mannopyranoside

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), Biotin conjugate, 0.1mg/mL
BNCB0149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p-Nitrophenyl 4,6-Benzylidene-Alpha-D-glucopyranoside
TRC-N503055-500MG 500 mg

p-Nitrophenyl 4,6-Benzylidene-Alpha-D-glucopyranoside

Sign In for Pricing
View Details
Sulfametrole
TRC-S699025-10MG 10 mg

Sulfametrole

Sign In for Pricing
View Details