Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIN2 Peptide - middle region

BIN2 Peptide - middle region

Product Specifications

Product Name Alternative

BRAP-1

UniProt

O00499

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001276936.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SLC25A33 Polyclonal Antibody
TMAB-12870-01 50 μL

Anti-SLC25A33 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SLC25A33 Polyclonal Antibody
TMAB-12870-02 100 µL

Anti-SLC25A33 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SLC25A33 Polyclonal Antibody
TMAB-12870-03 200 µL

Anti-SLC25A33 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human PQ-loop repeat-containing protein 1 (PQLC1), partial
MBS7094783 Inquire

Recombinant Human PQ-loop repeat-containing protein 1 (PQLC1), partial

Sign In for Pricing
View Details
HEF1/NEDD-9 Ab BSA/Azide Free
MBS5317192-01 0.05 mg

HEF1/NEDD-9 Ab BSA/Azide Free

Sign In for Pricing
View Details
HEF1/NEDD-9 Ab BSA/Azide Free
MBS5317192-02 5x 0.05 mg

HEF1/NEDD-9 Ab BSA/Azide Free

Sign In for Pricing
View Details