Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH5 Peptide - middle region

CDH5 Peptide - middle region

Product Specifications

Product Name Alternative

7B4, CD144

UniProt

P33151

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001786.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAK

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBPL Antibody (C-term)
orb1430230-01 50 µL

EBPL Antibody (C-term)

Sign In for Pricing
View Details
EBPL Antibody (C-term)
orb1430230-02 100 µL

EBPL Antibody (C-term)

Sign In for Pricing
View Details
Rabbit anti-FKBPL Antibody
MBS4509760-01 0.05 mL

Rabbit anti-FKBPL Antibody

Sign In for Pricing
View Details
Rabbit anti-FKBPL Antibody
MBS4509760-02 0.1 mL

Rabbit anti-FKBPL Antibody

Sign In for Pricing
View Details
Rabbit anti-FKBPL Antibody
MBS4509760-03 5x 0.1 mL

Rabbit anti-FKBPL Antibody

Sign In for Pricing
View Details
C920025E04Rik (BC094038) Mouse Tagged ORF Clone
MR202239 10 µg

C920025E04Rik (BC094038) Mouse Tagged ORF Clone

Sign In for Pricing
View Details