CDH5 Peptide - middle region
CDH5 Peptide - middle region
Product Specifications
Product Name Alternative
7B4, CD144
UniProt
P33151
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001786.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAK
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10455268 96 Well
Mouse Beta-type platelet-derived growth factor receptor ELISA kit
Sign In for Pricing
View Details 
27618065 1.0 µg DNA
LRRC1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details Mon Dec 31 11410 23:00:00 GMT+0000 (Coordinated Universal Time) 100 µg
Human CD277/BTN3A1 Recombinant Protein
Sign In for Pricing
View Details ![Rabbit Polyclonal MTMR1 Antibody [DyLight 680]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
MSM1X-102-P1 100ug
Anti-Golgi Complex Antibody Clone SPM581, Unconjugated-100ug
Sign In for Pricing
View Details