Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGAP1 Peptide - C-terminal region

ARFGAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARF1GAP, HRIHFB2281

UniProt

Q8N6T3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001268411.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI35 (N-term) Rabbit Polyclonal Antibody
AP52151PU-N 400 µL

IFI35 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRSS42 (NM_182702) Human Recombinant Protein
TP321595L 1 mg

PRSS42 (NM_182702) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit IgG (H&L) Antibody Texas Red™ Conjugated
TA397992 2 mg

Rabbit IgG (H&L) Antibody Texas Red™ Conjugated

Sign In for Pricing
View Details
Fgf21 (NM_020013) Mouse Recombinant Protein
TP502264 20 µg

Fgf21 (NM_020013) Mouse Recombinant Protein

Sign In for Pricing
View Details
2-Phenylbenzothiazole
TRC-P336635-1G 1 g

2-Phenylbenzothiazole

Sign In for Pricing
View Details
Major Basic Protein (PRG2) (NM_002728) Human Over-expression Lysate
LY400961 100 µg

Major Basic Protein (PRG2) (NM_002728) Human Over-expression Lysate

Sign In for Pricing
View Details