Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGAP1 Peptide - C-terminal region

ARFGAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARF1GAP, HRIHFB2281

UniProt

Q8N6T3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001268411.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMP PNP (~90%)
TRC-A634303-2.5MG 2.5 mg

AMP PNP (~90%)

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS808977 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
BRSK2 Antibody
KC-4006-01 50 μL

BRSK2 Antibody

Sign In for Pricing
View Details
BRSK2 Antibody
KC-4006-02 100 µL

BRSK2 Antibody

Sign In for Pricing
View Details
BRSK2 Antibody
KC-4006-03 1 mL

BRSK2 Antibody

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details