Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLUL Peptide - C-terminal region

GLUL Peptide - C-terminal region

Product Specifications

Product Name Alternative

GS, GLNS, PIG43, PIG59

UniProt

P15104

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028216.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human STK36 Pre-designed siRNA Set B
SI015944B 1 Each

Human STK36 Pre-designed siRNA Set B

Sign In for Pricing
View Details
K-Ras (G12C) inhibitor 9
MBS579097 Inquire

K-Ras (G12C) inhibitor 9

Sign In for Pricing
View Details
Lentiviral mouse Gm11568 shRNA (UAS) - Lentiviral mouse Gm11568 shRNA (UAS, iRFP) plasmid
GTR15267076 1 Vial

Lentiviral mouse Gm11568 shRNA (UAS) - Lentiviral mouse Gm11568 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Proteasome 19S S5A Polyclonal Antibody, HRP Conjugated
bs-8322R-HRP 100 µL

Proteasome 19S S5A Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Ndufb11 shRNA (UAS) - Lentiviral mouse Ndufb11 shRNA (UAS) (100)
GTR15186858 1 Vial

Lentiviral mouse Ndufb11 shRNA (UAS) - Lentiviral mouse Ndufb11 shRNA (UAS) (100)

Sign In for Pricing
View Details
Actin F (Filamentous) (HRP) discontinued
A0760-21-HRP 100 µL

Actin F (Filamentous) (HRP) discontinued

Sign In for Pricing
View Details