Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA8 Peptide - middle region

CDCA8 Peptide - middle region

Product Specifications

Product Name Alternative

BOR, DasraB, MESRGP, BOREALIN

UniProt

Q53HL2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin-1 / MUC-1 Recombinant Protein
orb1231151 0.1 mg

Mucin-1 / MUC-1 Recombinant Protein

Sign In for Pricing
View Details
DES Antibody, HRP conjugated
MBS7049612-01 0.05 mg

DES Antibody, HRP conjugated

Sign In for Pricing
View Details
DES Antibody, HRP conjugated
MBS7049612-02 0.1 mg

DES Antibody, HRP conjugated

Sign In for Pricing
View Details
DES Antibody, HRP conjugated
MBS7049612-03 5x 0.1 mg

DES Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Human HPV B19 Capsid protein VP1 Protein, His, E.coli-10ug
QP7371-ec-10ug 10ug

Recombinant Human HPV B19 Capsid protein VP1 Protein, His, E.coli-10ug

Sign In for Pricing
View Details
Anti-Rat CD100/SEMA4D Antibody (SAA0335), APC
MBS1586257-01 50 Tests

Anti-Rat CD100/SEMA4D Antibody (SAA0335), APC

Sign In for Pricing
View Details