Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA8 Peptide - middle region

CDCA8 Peptide - middle region

Product Specifications

Product Name Alternative

BOR, DasraB, MESRGP, BOREALIN

UniProt

Q53HL2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc17a1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6971404 1.0 µg DNA

Slc17a1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human PSMD8 Knockout A549 cell line
GTR15405630 1 Vial

Human PSMD8 Knockout A549 cell line

Sign In for Pricing
View Details
Actin β Polyclonal Antibody
RA20472-01 50 µL

Actin β Polyclonal Antibody

Sign In for Pricing
View Details
Actin β Polyclonal Antibody
RA20472-02 100 µL

Actin β Polyclonal Antibody

Sign In for Pricing
View Details
NH2-c[X-R-L-S-X]-K-G-P- (D-1Nal)
T76223-01 5 mg

NH2-c[X-R-L-S-X]-K-G-P- (D-1Nal)

Sign In for Pricing
View Details
NH2-c[X-R-L-S-X]-K-G-P- (D-1Nal)
T76223-02 50 mg

NH2-c[X-R-L-S-X]-K-G-P- (D-1Nal)

Sign In for Pricing
View Details