Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR2 Peptide - middle region

MTMR2 Peptide - middle region

Product Specifications

Product Name Alternative

CMT4B, CMT4B1

UniProt

Q13614

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230500.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stil Mouse Gene Knockout Kit (CRISPR)
KN516863 1 Kit

Stil Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Apolipoprotein E (APOE) (NM_000041) Human Recombinant Protein
TP750216 50 µg

Apolipoprotein E (APOE) (NM_000041) Human Recombinant Protein

Sign In for Pricing
View Details
L-Leucyl-L-tyrosine
TRC-L330183-50MG 50 mg

L-Leucyl-L-tyrosine

Sign In for Pricing
View Details
Anti Human FNTB Polyclonal
Y055470 100 µL

Anti Human FNTB Polyclonal

Sign In for Pricing
View Details
PRCP (NM_199418) Human Over-expression Lysate
LC403704 20 µg

PRCP (NM_199418) Human Over-expression Lysate

Sign In for Pricing
View Details
C20orf118 (TLDC2) Human Gene Knockout Kit (CRISPR)
KN415304 1 Kit

C20orf118 (TLDC2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details