Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAIM2 Peptide - N-terminal region

FAIM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LFG, LFG2, NGP35, NMP35, TMBIM2

UniProt

Q9BWQ8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036438.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF405S conjugate, 0.1mg/mL
BNC042289-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL
BNC680334-500 1x 500 µL

Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF488A conjugate, 0.1mg/mL
BNC882904-100 1x 100 µL

WIPI2 (2A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/1766R), CF488A conjugate, 0.1mg/mL
BNC881766-500 1x 500 µL

CD43 (T-Cell Marker) (SPN/1766R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details