Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EYA4 Peptide - middle region

EYA4 Peptide - middle region

Product Specifications

Product Name Alternative

CMD1J, DFNA10

UniProt

O95677

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001287941.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKDLDERTCRSSGSKSRGRGRKNNPSPPPDSDLERVFVWDLDETIIVFHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CHGA protein (His tag)
PDMH100095-01 20 µg

Recombinant Human CHGA protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CHGA protein (His tag)
PDMH100095-02 100 µg

Recombinant Human CHGA protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CHGA protein (His tag)
PDMH100095-03 500 µg

Recombinant Human CHGA protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CHGA protein (His tag)
PDMH100095-04 1 mg

Recombinant Human CHGA protein (His tag)

Sign In for Pricing
View Details
DCP1B Mouse Monoclonal Antibody [Clone ID: OTI1B5]
CF809933 100 µg

DCP1B Mouse Monoclonal Antibody [Clone ID: OTI1B5]

Sign In for Pricing
View Details
ID3 Human Gene Knockout Kit (CRISPR)
KN400583 1 Kit

ID3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details