Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EYA4 Peptide - middle region

EYA4 Peptide - middle region

Product Specifications

Product Name Alternative

CMD1J, DFNA10

UniProt

O95677

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001287941.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKDLDERTCRSSGSKSRGRGRKNNPSPPPDSDLERVFVWDLDETIIVFHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3GL2 (NM_003026) Human Recombinant Protein
TP315806 20 µg

SH3GL2 (NM_003026) Human Recombinant Protein

Sign In for Pricing
View Details
Profilin 1 Recombinant Rabbit Monoclonal Antibody [JA30-13]
ET1704-42 100 µL

Profilin 1 Recombinant Rabbit Monoclonal Antibody [JA30-13]

Sign In for Pricing
View Details
2-Ethyl-1,3-hexanediol
TRC-E918768-250G 250 g

2-Ethyl-1,3-hexanediol

Sign In for Pricing
View Details
BTBD14A (NACC2) (C-term) Rabbit Polyclonal Antibody
AP52805PU-N 400 µL

BTBD14A (NACC2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NBT (Nitro Blue Tetrazolium, Chloride), 1 g
#10008-1 1x 1 g

NBT (Nitro Blue Tetrazolium, Chloride), 1 g

Sign In for Pricing
View Details
GPR32 Human Gene Knockout Kit (CRISPR)
KN209670BN 1 Kit

GPR32 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details