Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP110 Peptide - N-terminal region

SP110 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IPR1, VODI, IFI41, IFI75

UniProt

Q9HB58

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171944.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Prokineticin 1 (PROK1) activation kit by CRISPRa
GA113540 1 Kit

Human Prokineticin 1 (PROK1) activation kit by CRISPRa

Sign In for Pricing
View Details
Porcine Atrial Natriuretic Peptide (ANP) ELISA Kit
RD-ANP-p-01 96 Tests

Porcine Atrial Natriuretic Peptide (ANP) ELISA Kit

Sign In for Pricing
View Details
Porcine Atrial Natriuretic Peptide (ANP) ELISA Kit
RD-ANP-p-02 48 Tests

Porcine Atrial Natriuretic Peptide (ANP) ELISA Kit

Sign In for Pricing
View Details
GCHFR Rabbit Polyclonal Antibody
TA362766 100 µL

GCHFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (N/A), CF488A conjugate, 0.1mg/mL
BNC881816-500 1x 500 µL

Histone H1 (Pan Nuclear Marker) (N/A), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF647 conjugate, 0.1mg/mL
BNC471853-100 1x 100 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details