Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP2 Peptide - middle region

STXBP2 Peptide - middle region

Product Specifications

Product Name Alternative

FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, MUNC18-2

UniProt

Q15833

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001120868.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQLAHAVLAKLNAFKADTPSLGEGPEKTRSQLLIMDRAADPVSPLLHELT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (Late Endosomes Marker) (LAMP3/2990R), 1mg/mL
BNUM2990-50 1x 50 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), 1mg/mL

Sign In for Pricing
View Details
GCP4 (TUBGCP4) Rabbit Polyclonal Antibody
AP01473PU-N 100 µg

GCP4 (TUBGCP4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-(Cyclohexylthio)phthalimide
TRC-N272830-1G 1 g

N-(Cyclohexylthio)phthalimide

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS713432 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Cyclosporin C
TRC-C988905-50MG 50 mg

Cyclosporin C

Sign In for Pricing
View Details
Ubr1 Mouse Gene Knockout Kit (CRISPR)
KN518619 1 Kit

Ubr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details