Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP2 Peptide - middle region

STXBP2 Peptide - middle region

Product Specifications

Product Name Alternative

FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, MUNC18-2

UniProt

Q15833

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001120868.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQLAHAVLAKLNAFKADTPSLGEGPEKTRSQLLIMDRAADPVSPLLHELT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRN3 (NM_001099660) Human Over-expression Lysate
LY420477 100 µg

LRRN3 (NM_001099660) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF114 activation kit by CRISPRa
GA116074 1 Kit

Human ZNF114 activation kit by CRISPRa

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), Biotin conjugate, 0.1mg/mL
BNCB2729-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Helixyte™ iFluor® 350 Nucleic Acid Labeling Dye *Optimized for Labeling 100-300 ug DNA/RNA*
17950-AAT 1 mg

Helixyte™ iFluor® 350 Nucleic Acid Labeling Dye *Optimized for Labeling 100-300 ug DNA/RNA*

Sign In for Pricing
View Details
Rabbit IgG heavy chain Mouse Monoclonal Antibody [C3-C8]
M1009-6 100 µL

Rabbit IgG heavy chain Mouse Monoclonal Antibody [C3-C8]

Sign In for Pricing
View Details
NTH1 (NTHL1) (NM_002528) Human Recombinant Protein
TP314598M 100 µg

NTH1 (NTHL1) (NM_002528) Human Recombinant Protein

Sign In for Pricing
View Details