CDC14B Peptide - N-terminal region
CDC14B Peptide - N-terminal region
Product Specifications
Product Name Alternative
CDC14B3, Cdc14B1, Cdc14B2, hCDC14B
UniProt
O60729
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001070649.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6493256-01 0.1 mL
Phospholamban, Phosphorylated (Ser16) (Biotin)
Sign In for Pricing
View Details MBS6493256-02 5x 0.1 mL
Phospholamban, Phosphorylated (Ser16) (Biotin)
Sign In for Pricing
View Details 
042131-APC 200 µL
SOCS4, ID (SOCS4, SOCS7, Suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7) (APC) discontinued
Sign In for Pricing
View Details