Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC14B Peptide - N-terminal region

CDC14B Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDC14B3, Cdc14B1, Cdc14B2, hCDC14B

UniProt

O60729

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001070649.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neprilysin
AP85476 1 mg

Neprilysin

Sign In for Pricing
View Details
Stat5a (NM_017064) Rat Untagged Clone
RN204211 10 µg

Stat5a (NM_017064) Rat Untagged Clone

Sign In for Pricing
View Details
Rabbit Polyclonal AAK1 Antibody
NBP1-76343-0.025mg 0.025 mg

Rabbit Polyclonal AAK1 Antibody

Sign In for Pricing
View Details
Integrin α2 (P4B4)
sc-53506 200 µg/mL

Integrin α2 (P4B4)

Sign In for Pricing
View Details
ERGIC2 Polyclonal Antibody
RD84455A-01 60μL

ERGIC2 Polyclonal Antibody

Sign In for Pricing
View Details
ERGIC2 Polyclonal Antibody
RD84455A-02 120μL

ERGIC2 Polyclonal Antibody

Sign In for Pricing
View Details