What is the catalog number for CDC14B Peptide - middle region?

The catalog number for CDC14B Peptide - middle region is orb1999162.

What sizes are available for CDC14B Peptide - middle region?

CDC14B Peptide - middle region is available in the following size(s): 100 µg.

Is CDC14B Peptide - middle region in stock?

CDC14B Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CDC14B Peptide - middle region

Product Specifications

Product Name Alternative

CDC14B3, Cdc14B1, Cdc14B2, hCDC14B

UniProt

O60729

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001070649.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS475972-01 0.1 mL

Anti-FABP2 Mouse mAb

Sign In for Pricing

View Details

MBS475972-02 5x 0.1 mL

Anti-FABP2 Mouse mAb

Sign In for Pricing

View Details

HK200459 1 Kit

YTHDF1 Human qPCR Template Standard (AK095795)

Sign In for Pricing

View Details

TL512681V 500 µL Each

Msx3 Mouse shRNA Lentiviral Particle (Locus ID 17703)

Sign In for Pricing

View Details

E45M16637V-2 50 µL

MOX1 (MEOX1) Mouse Monoclonal Antibody [Clone 1D1]

Sign In for Pricing

View Details

MR211520 10 µg

Gtf2ird1 (NM_001081465) Mouse Tagged ORF Clone

Sign In for Pricing

View Details