CDC14B Peptide - middle region
CDC14B Peptide - middle region
Product Specifications
Product Name Alternative
CDC14B3, Cdc14B1, Cdc14B2, hCDC14B
UniProt
O60729
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001070649.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
485964 100 µL
MNS1 (Meiosis-Specific Nuclear Structural Protein 1, Meiosis-specific Nuclear Structural 1)
Sign In for Pricing
View Details 
VAng-Lsx9238-1mgEcoli 1 mg (E. coli)
Recombinant Clostridium Difficile murC Protein (aa 1-450)
Sign In for Pricing
View Details MBS076899 Inquire
Donkey Survival of Motor Neuron 2, Centromeric ELISA Kit
Sign In for Pricing
View Details 
MBS7223204-01 48 Well
Bovine Branched-chain-amino-acid aminotransferase, mitochondrial (BCAT2) ELISA Kit
Sign In for Pricing
View Details MBS7223204-02 96 Well
Bovine Branched-chain-amino-acid aminotransferase, mitochondrial (BCAT2) ELISA Kit
Sign In for Pricing
View Details