Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGK Peptide - middle region

AGK Peptide - middle region

Product Specifications

Product Name Alternative

MULK, CATC5, CTRCT38, MTDPS10

UniProt

Q53H12

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPO2 Human Gene Knockout Kit (CRISPR)
KN424177 1 Kit

RSPO2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human NPIPL2 (NPIPB15) activation kit by CRISPRa
GA118452 1 Kit

Human NPIPL2 (NPIPB15) activation kit by CRISPRa

Sign In for Pricing
View Details
Human OSTM1 activation kit by CRISPRa
GA109172 1 Kit

Human OSTM1 activation kit by CRISPRa

Sign In for Pricing
View Details
PIGT Polyclonal Antibody
E-AB-90345-01 60 µL

PIGT Polyclonal Antibody

Sign In for Pricing
View Details
PIGT Polyclonal Antibody
E-AB-90345-02 120 µL

PIGT Polyclonal Antibody

Sign In for Pricing
View Details
PIGT Polyclonal Antibody
E-AB-90345-03 200 µL

PIGT Polyclonal Antibody

Sign In for Pricing
View Details