BRCC3 Peptide - middle region
BRCC3 Peptide - middle region
Product Specifications
Product Name Alternative
C6.1A, BRCC36, CXorf53
UniProt
P46736
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001018065.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAAST
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15227761 1 Vial
Lentiviral mouse Zfp3 shRNA (UAS) - Lentiviral mouse Zfp3 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details GTR15301052 1 Vial
Lentiviral mouse Cyc1 shRNA (UAS) - Lentiviral mouse Cyc1 shRNA (UAS) (25)
Sign In for Pricing
View Details MBS9017593 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) XYL2 Polyclonal Antibody
Sign In for Pricing
View Details 
30336151 3x 1.0 µg DNA
MOSPD1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details