BRCC3 Peptide - middle region
BRCC3 Peptide - middle region
Product Specifications
Product Name Alternative
C6.1A, BRCC36, CXorf53
UniProt
P46736
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001018065.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAAST
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E28PP0431 100 µL
PDGFR-β (phospho Tyr771) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details GTR10465046 96 Well
Chicken Mediator of RNA polymerase II transcription subunit 16 (MED16) ELISA kit
Sign In for Pricing
View Details 
226141-01 50 µL
Synoretin (Gamma-Synuclein, y-Synuclein, Synuclein y, Synuclein-y, Breast Cancer-specific Gene 1 Protein, Persyn, Synoretin, SR, SNCG, BCSG1, PERSYN, PRSN) discontinued
Sign In for Pricing
View Details 226141-02 100 µL
Synoretin (Gamma-Synuclein, y-Synuclein, Synuclein y, Synuclein-y, Breast Cancer-specific Gene 1 Protein, Persyn, Synoretin, SR, SNCG, BCSG1, PERSYN, PRSN) discontinued
Sign In for Pricing
View Details 
BP2872-500ug 500 µg
Recombinant Human Pre-rRNA-processing protein TSR1 homolog/TSR1 (C-His)
Sign In for Pricing
View Details