Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANBP9 Peptide - middle region

RANBP9 Peptide - middle region

Product Specifications

Product Name Alternative

BPM-L, BPM90, RANBPM, RanBP7

UniProt

Q6VN20

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005484.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cholecystokinin 8, Octapeptide (CCK8) BioAssayTM ELISA Kit (Guinea Pig)
152405 96 Tests

Cholecystokinin 8, Octapeptide (CCK8) BioAssayTM ELISA Kit (Guinea Pig)

Sign In for Pricing
View Details
GlyRS (D-10) PE
sc-365311 PE 200 µg/mL

GlyRS (D-10) PE

Sign In for Pricing
View Details
OLR785 Adenovirus (Rat)
34680056 1.0 mL

OLR785 Adenovirus (Rat)

Sign In for Pricing
View Details
Occludin (F-7) HRP
sc-271842 HRP 200 µg/mL

Occludin (F-7) HRP

Sign In for Pricing
View Details
Mouse Chitinase 1 (CHIT1) ELISA Kit
EKN44237 96 Tests

Mouse Chitinase 1 (CHIT1) ELISA Kit

Sign In for Pricing
View Details
NEB2 Conjugated Antibody
C44497 100 µL

NEB2 Conjugated Antibody

Sign In for Pricing
View Details